Visualizza carrello “PT-141 (Bremelanotide) – 10 mg.” è stato aggiunto al tuo carrello.

Possiamo consegnare questo prodotto in qualsiasi località d’Italia e in tutti gli altri Paesi europei. Per un prezzo esatto, i tempi di consegna e le altre condizioni, La invitiamo a consultare le informazioni o a inviarci una richiesta QUI!

Fino al 11.12.2025 questo prodotto è stato ordinato e acquistato da 135 clienti soddisfatti e le recensioni sono tutte positive.

x
- Confermi che possiamo usare questo numero di telefono per contattarLa!

Se ha difficoltà a effettuare un ordine su Zobimit.COM, clicchi qui per guardare il nostro video con le istruzioni su come ordinare da noi in modo rapido e semplice!

Paese d’origine:
In offerta!

IGF-1 LR3 (con acqua batteriostatica inclusa) – 10 amp. x 1 mg.

349.90

Вземи срещу 21000 промо точки
Купи и спечели 350 промо точки!

IGF1 LR3 (Long R3 Insulin-like Growth Factor) is a polypeptide hormone with properties similar to insulin. However, LR3 is a modified form of IGF1 to increase half-life and to prevent deactivation due to protein binding.

COD: IGFLR3-AVIVA Categoria: Produttore:

Product Description

IGF1 LR3 (Long R3 Insulin-like Growth Factor) is a polypeptide hormone with properties similar to insulin. However, LR3 is a modified form of IGF1 to increase half-life and to prevent deactivation due to protein binding. IGF1 LR3 contains 83 amino acids with substitution of Arginine instead of Glutamic acid at position 3. Altered polypeptide sequence prevents protein binding and increases half-life. The biomolecule exert fat metabolizing properties in addition with transportation of glucose and amino acids into the cells to aid protein biosynthesis. Research evidences suggest that IGF1 LR3 promote muscle cell hyperplasia, increase neuro-functions and nitrogen retention in cells. The molecular weight and molecular mass of IGF1 LR3 is 9.200 and C990H1528N262O300S7, respectively.

IGF1-LR3 Chemical Profile

CAS: 946870-92-4
Formula: C990H1528N262O300S7
Molecular weight: 9200
Peptide purity: > 99.0%
Chain: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIV DECCFRSCDLRRLEMYCAPLKPAKSA

Recensioni

Ancora non ci sono recensioni.

Solamente clienti che hanno effettuato l'accesso ed hanno acquistato questo prodotto possono lasciare una recensione.